Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Dac g 4 protein

This Rat Dac g 4 protein spans the amino acid sequence from region 1-55aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Major pollen allergen Dac g 4, allergen Dac g 4, Fragments

UniProt

P82946

Expression Region

1-55aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Dactylis glomerata (Orchard grass) (Cock's-foot grass)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-55aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DIYNYMEPYVSKVDPTDYFGNEQARTAWVDSGAQLGELSYGVLFNIQYVNYWFAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS803344 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Silver(I) Fluoride
TRC-S465050-5G 5 g

Silver(I) Fluoride

Sign In for Pricing
View Details
CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), CF488A conjugate, 0.1mg/mL
BNC882884-100 1x 100 µL

CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glutathione Peroxidase 4 Antibody (Biotin)
KB-21179-01 50 μL

Glutathione Peroxidase 4 Antibody (Biotin)

Sign In for Pricing
View Details
Glutathione Peroxidase 4 Antibody (Biotin)
KB-21179-02 100 µL

Glutathione Peroxidase 4 Antibody (Biotin)

Sign In for Pricing
View Details
Glutathione Peroxidase 4 Antibody (Biotin)
KB-21179-03 1 mL

Glutathione Peroxidase 4 Antibody (Biotin)

Sign In for Pricing
View Details