Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Dac g 4 protein

This Rat Dac g 4 protein spans the amino acid sequence from region 1-55aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Major pollen allergen Dac g 4, allergen Dac g 4, Fragments

UniProt

P82946

Expression Region

1-55aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Dactylis glomerata (Orchard grass) (Cock's-foot grass)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-55aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DIYNYMEPYVSKVDPTDYFGNEQARTAWVDSGAQLGELSYGVLFNIQYVNYWFAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLUD1 Human Gene Knockout Kit (CRISPR)
KN211132LP 1 Kit

GLUD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LATS2 (Center) Rabbit Polyclonal Antibody
AP13576PU-N 400 µL

LATS2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CDK15 Mouse Monoclonal Antibody [Clone ID: OTI2D5]
CF809460 100 µg

CDK15 Mouse Monoclonal Antibody [Clone ID: OTI2D5]

Sign In for Pricing
View Details
Benzyl Nicotinate
TRC-B285465-5G 5 g

Benzyl Nicotinate

Sign In for Pricing
View Details
trans-3'-Hydroxy Cotinine Acetate
TRC-H924508-25MG 25 mg

trans-3'-Hydroxy Cotinine Acetate

Sign In for Pricing
View Details
Aamdc Mouse Gene Knockout Kit (CRISPR)
KN500583 1 Kit

Aamdc Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details