Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Dac g 4 protein

This Rat Dac g 4 protein spans the amino acid sequence from region 1-55aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Major pollen allergen Dac g 4, allergen Dac g 4, Fragments

UniProt

P82946

Expression Region

1-55aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Dactylis glomerata (Orchard grass) (Cock's-foot grass)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-55aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DIYNYMEPYVSKVDPTDYFGNEQARTAWVDSGAQLGELSYGVLFNIQYVNYWFAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Breast
CS502520 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
TNF alpha (J2D10), Biotin conjugate, 0.1mg/mL
BNCB0994-100 1x 100 µL

TNF alpha (J2D10), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C7orf59 (LAMTOR4) (NM_001008395) Human Over-expression Lysate
LC423422 20 µg

C7orf59 (LAMTOR4) (NM_001008395) Human Over-expression Lysate

Sign In for Pricing
View Details
Diglycolic Acid-d4 Sodium Salt
TRC-D446337-1MG 1 mg

Diglycolic Acid-d4 Sodium Salt

Sign In for Pricing
View Details
FBLN5 Antibody
8C15754-AAT 50 µg

FBLN5 Antibody

Sign In for Pricing
View Details
TFPI Mouse Monoclonal Antibody [Clone ID: OTI3C2]
CF805998 100 µg

TFPI Mouse Monoclonal Antibody [Clone ID: OTI3C2]

Sign In for Pricing
View Details