Plant Ribosome-inactivating protein lychnin protein
This Plant Ribosome-inactivating protein lychnin protein spans the amino acid sequence from region 1-234aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Ribosome-inactivating protein lychnin, EC 3.2.2.22
UniProt
P85101
Expression Region
1-234aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Silene chalcedonica (Maltese-cross) (Lychnis chalcedonica)
Field of Research
Cell Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
30.1 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full length of His-tag and expression region is 1-234aa
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
RPSWTVDSDSAKYSSFLDSLREEFGRGTPKVCNIPVTKKANNDKFVLVNLVLPFNRNTITLAFRASDAYLVGFQDRDSKTNKLRANFFSDEYRALSGKYKSIFTDAEVLAPALPCASTYTDLQNKAGVSREKLSLGVSSLQTAFTAVYGKVFTGKNVAKFALISIQMVAEAARFKYIEDQVINRGMYSSFEAGARITLLENNWSKISEQYHKSCKLGGGQFTEEEMKLGLLLYN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470012-500 1x 500 µL
Tyrosinase (T311), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040050-500 1x 500 µL
IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740178-100 1x 100 µL
CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040181-100 1x 100 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882685-500 1x 500 µL
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2685), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details