Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TRIM24 protein

This Human TRIM24 protein spans the amino acid sequence from region 891-1012aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

E3 ubiquitin-protein ligase TRIM24RING finger protein 82Tripartite motif-containing protein 24

UniProt

O15164

Expression Region

891-1012aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of His-SUMO-tag and expression region is 891-1012aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-IL-1R2 Antibody
MBS4513670-01 0.05 mL

Rabbit anti-IL-1R2 Antibody

Sign In for Pricing
View Details
Rabbit anti-IL-1R2 Antibody
MBS4513670-02 0.1 mL

Rabbit anti-IL-1R2 Antibody

Sign In for Pricing
View Details
Rabbit anti-IL-1R2 Antibody
MBS4513670-03 5x 0.1 mL

Rabbit anti-IL-1R2 Antibody

Sign In for Pricing
View Details
Nori® Sheep alpha-defensin 1 ELISA Kit
GR116232 96 Well

Nori® Sheep alpha-defensin 1 ELISA Kit

Sign In for Pricing
View Details
Mouse Pcgf2 Pre-designed siRNA Set A
SI110221A 1 Each

Mouse Pcgf2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
CCDC13, NT (CCDC13, Coiled-coil domain-containing protein 13) (APC) discontinued
033293-APC 200 µL

CCDC13, NT (CCDC13, Coiled-coil domain-containing protein 13) (APC) discontinued

Sign In for Pricing
View Details