Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sheep TNF protein

This Sheep TNF protein spans the amino acid sequence from region 78-234aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cachectin, TNF-alphaTumor necrosis factor ligand superfamily member 2 , TNF-a

UniProt

P23383

Expression Region

78-234aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Ovis aries (Sheep)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 78-234aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR6 (NM_005284) Human Tagged Lenti ORF Clone
RC207204L2 10 µg

GPR6 (NM_005284) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Bovine acidic fibroblast growth factor (aFGF) ELISA Kit
OM621833 96 Strip Well

Bovine acidic fibroblast growth factor (aFGF) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human FBXO48 shRNA (UAS) - Lentiviral human FBXO48 shRNA (UAS, iRFP) plasmid
GTR15155992 1 Vial

Lentiviral human FBXO48 shRNA (UAS) - Lentiviral human FBXO48 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Mouse IgG1 (heavy chain) Rat Monoclonal Antibody [Clone ID: LO-MG1-2]
SM1017F 500 µg

Mouse IgG1 (heavy chain) Rat Monoclonal Antibody [Clone ID: LO-MG1-2]

Sign In for Pricing
View Details
Bovine Stabilin-1 (STAB1) ELISA Kit
MBS9359142-01 48 Well

Bovine Stabilin-1 (STAB1) ELISA Kit

Sign In for Pricing
View Details
Bovine Stabilin-1 (STAB1) ELISA Kit
MBS9359142-02 96 Well

Bovine Stabilin-1 (STAB1) ELISA Kit

Sign In for Pricing
View Details