Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sheep TNF protein

This Sheep TNF protein spans the amino acid sequence from region 78-234aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cachectin, TNF-alphaTumor necrosis factor ligand superfamily member 2 , TNF-a

UniProt

P23383

Expression Region

78-234aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Ovis aries (Sheep)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 78-234aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal EDNRB / Endothelin B Receptor Antibody (N-Terminus)
AMM07008G 0.05mg

Polyclonal EDNRB / Endothelin B Receptor Antibody (N-Terminus)

Sign In for Pricing
View Details
TBC1D23 Antibody
orb423132-01 50 µg

TBC1D23 Antibody

Sign In for Pricing
View Details
TBC1D23 Antibody
orb423132-02 100 µg

TBC1D23 Antibody

Sign In for Pricing
View Details
IKBKB Antibody, FITC conjugated
A46361-50UG 50 µg

IKBKB Antibody, FITC conjugated

Sign In for Pricing
View Details
Easypro Rat Galectin 2 (GAL2) ELISA Kit
FY-ER1591S 96 Well

Easypro Rat Galectin 2 (GAL2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human MCM7 Protein, N-His
bs-103947P-01 20 µg

Recombinant Human MCM7 Protein, N-His

Sign In for Pricing
View Details