Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Socs3 protein

This Rat Socs3 protein spans the amino acid sequence from region 1-225aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytokine-inducible SH2 protein 3

UniProt

O88583

Expression Region

1-225aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-225aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVETQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFSLPPTEPSFEVQEQPPAQALPGGTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Muller’s Fixative
V0190 00500 500 mL

Muller’s Fixative

Sign In for Pricing
View Details
Rat Vitamin D Receptor (VDR) ELISA Kit
MBS265854-01 48 Well

Rat Vitamin D Receptor (VDR) ELISA Kit

Sign In for Pricing
View Details
Rat Vitamin D Receptor (VDR) ELISA Kit
MBS265854-02 96 Well

Rat Vitamin D Receptor (VDR) ELISA Kit

Sign In for Pricing
View Details
Rat Vitamin D Receptor (VDR) ELISA Kit
MBS265854-03 5x 96 Well

Rat Vitamin D Receptor (VDR) ELISA Kit

Sign In for Pricing
View Details
Rat Vitamin D Receptor (VDR) ELISA Kit
MBS265854-04 10x 96 Well

Rat Vitamin D Receptor (VDR) ELISA Kit

Sign In for Pricing
View Details
Mouse Slc16a6 (NM_001029842) AAV Particle
MR224927A1V 250 µL

Mouse Slc16a6 (NM_001029842) AAV Particle

Sign In for Pricing
View Details