Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Pcsk5 protein

This Mouse Pcsk5 protein spans the amino acid sequence from region 117-452aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Proprotein convertase 5 , PC5Proprotein convertase 6 , PC6Subtilisin-like proprotein convertase 6 , SPC6Subtilisin/kexin-like protease PC5

UniProt

Q04592

Expression Region

117-452aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Catalytic of His-SUMO-tag and expression region is 117-452aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DYDLSHAQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAATANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKSVSYNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYSSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSRAGHLNANDWKTNAAGFKVSHLYGFGLMDAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tiragolumab Biosimilar - Research Grade
ICH5078-50mg 50 mg

Tiragolumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Human ATG9A qPCR Primer Pair
QH09069S 200 Tests

Human ATG9A qPCR Primer Pair

Sign In for Pricing
View Details
Recombinant E.coli Chaperone protein DnaK Protein, His, E.coli-50ug
QP7629-ec-50ug 50ug

Recombinant E.coli Chaperone protein DnaK Protein, His, E.coli-50ug

Sign In for Pricing
View Details
TMEM120A Rabbit pAb, AP conjugated
orb2875118 100 µL

TMEM120A Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
RAD50 Interactor 1 (RINT1) Antibody
abx301439-01 20 µg

RAD50 Interactor 1 (RINT1) Antibody

Sign In for Pricing
View Details
RAD50 Interactor 1 (RINT1) Antibody
abx301439-02 50 µg

RAD50 Interactor 1 (RINT1) Antibody

Sign In for Pricing
View Details