Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Pcsk5 protein

This Mouse Pcsk5 protein spans the amino acid sequence from region 117-452aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Proprotein convertase 5 , PC5Proprotein convertase 6 , PC6Subtilisin-like proprotein convertase 6 , SPC6Subtilisin/kexin-like protease PC5

UniProt

Q04592

Expression Region

117-452aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Catalytic of His-SUMO-tag and expression region is 117-452aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DYDLSHAQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAATANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKSVSYNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYSSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSRAGHLNANDWKTNAAGFKVSHLYGFGLMDAE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDM4 antibody
70R-34534 0.1 mg

MDM4 antibody

Sign In for Pricing
View Details
AR shRNA (bovine) Lentiviral Particles
sc-270398-V 200 µL

AR shRNA (bovine) Lentiviral Particles

Sign In for Pricing
View Details
HiPurA® Plasmid DNA Midiprep Purificatio
MB509-25PR 1 unit

HiPurA® Plasmid DNA Midiprep Purificatio

Sign In for Pricing
View Details
Fish HMG Box-Containing Protein 1 (HBP1) ELISA Kit
MBS9380053 Inquire

Fish HMG Box-Containing Protein 1 (HBP1) ELISA Kit

Sign In for Pricing
View Details
MRas Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-1882R-BF488 100 µL

MRas Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
FABP5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0709107 1.0 µg DNA

FABP5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details