Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine INHA protein

This Bovine INHA protein spans the amino acid sequence from region 227-360aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

INHA, Inhibin alpha chain

UniProt

P07994

Expression Region

227-360aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Inhibin alpha chain of His-SUMO-tag and expression region is 227-360aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STPPLPWPWSPAALRLLQRPPEEPAAHADCHRAALNISFQELGWDRWIVHPPSFIFYYCHGGCGLSPPQDLPLPVPGVPPTPVQPLSLVPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYEMVPNLLTQHCACI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Agrin (AGRN)
RPU52563-01 50 µg

Recombinant Rat Agrin (AGRN)

Sign In for Pricing
View Details
Recombinant Rat Agrin (AGRN)
RPU52563-02 100 µg

Recombinant Rat Agrin (AGRN)

Sign In for Pricing
View Details
Recombinant Rat Agrin (AGRN)
RPU52563-03 1 mg

Recombinant Rat Agrin (AGRN)

Sign In for Pricing
View Details
Human Calcineurin (CaN) ELISA Kit
MBS455514-01 48 Tests

Human Calcineurin (CaN) ELISA Kit

Sign In for Pricing
View Details
Human Calcineurin (CaN) ELISA Kit
MBS455514-02 96 Tests

Human Calcineurin (CaN) ELISA Kit

Sign In for Pricing
View Details
Human Calcineurin (CaN) ELISA Kit
MBS455514-03 5x 96 Tests

Human Calcineurin (CaN) ELISA Kit

Sign In for Pricing
View Details