Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IDUA protein

This Human IDUA protein spans the amino acid sequence from region 28-653aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IDUA, Alpha-L-iduronidase, EC 3.2.1.76

UniProt

P35475

Expression Region

28-653aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

73.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 28-653aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APHLVHVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLEVPVPRGPPSPGNP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hCA/VEGFR-2-IN-2
MBS5821249 Inquire

hCA/VEGFR-2-IN-2

Sign In for Pricing
View Details
MGluR6 Rabbit Polyclonal Antibody (Cy3)
orb978530 100 µL

MGluR6 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
RPS4P5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2010807 1.0 µg DNA

RPS4P5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Pptc7 (NM_177242) Mouse Tagged ORF Clone
MR204400 10 µg

Pptc7 (NM_177242) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CCDC40 HDR Plasmid (h)
sc-412424-HDR 20 µg

CCDC40 HDR Plasmid (h)

Sign In for Pricing
View Details
Lentiviral human PRKCD shRNA (UAS) - Lentiviral human PRKCD shRNA (UAS) (100)
GTR15086562 1 Vial

Lentiviral human PRKCD shRNA (UAS) - Lentiviral human PRKCD shRNA (UAS) (100)

Sign In for Pricing
View Details