Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IDUA protein

This Human IDUA protein spans the amino acid sequence from region 28-653aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IDUA, Alpha-L-iduronidase, EC 3.2.1.76

UniProt

P35475

Expression Region

28-653aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

73.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 28-653aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APHLVHVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLEVPVPRGPPSPGNP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nppb ORF Vector (Mouse) (pORF)
32095014 1.0 µg DNA

Nppb ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Fluor430-conjugated Polyclonal Rabbit Anti-Mouse IgG (H+L) Secondary Antibody
APS0714-01 200 µL

Fluor430-conjugated Polyclonal Rabbit Anti-Mouse IgG (H+L) Secondary Antibody

Sign In for Pricing
View Details
Fluor430-conjugated Polyclonal Rabbit Anti-Mouse IgG (H+L) Secondary Antibody
APS0714-02 500 µL

Fluor430-conjugated Polyclonal Rabbit Anti-Mouse IgG (H+L) Secondary Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal VIPAR Antibody [Alexa Fluor 350]
NBP2-04091AF350 0.1 mL

Rabbit Polyclonal VIPAR Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Polyclonal Antibody to Fibroblast Growth Factor Receptor Substrate 2 (FRS2)
MBS2026205-01 0.1 mL

Polyclonal Antibody to Fibroblast Growth Factor Receptor Substrate 2 (FRS2)

Sign In for Pricing
View Details
Polyclonal Antibody to Fibroblast Growth Factor Receptor Substrate 2 (FRS2)
MBS2026205-02 0.2 mL

Polyclonal Antibody to Fibroblast Growth Factor Receptor Substrate 2 (FRS2)

Sign In for Pricing
View Details