Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IDUA protein

This Human IDUA protein spans the amino acid sequence from region 28-653aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IDUA, Alpha-L-iduronidase, EC 3.2.1.76

UniProt

P35475

Expression Region

28-653aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

73.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 28-653aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APHLVHVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLEVPVPRGPPSPGNP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xab2 (NM_026156) Mouse Tagged ORF Clone Lentiviral Particle
MR210960L4V 200 µL

Xab2 (NM_026156) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
NCOR2 Antibody
E19-8896-1 50 µg - 50 µL

NCOR2 Antibody

Sign In for Pricing
View Details
Wdr77 3'UTR Lenti-reporter-Luc Vector
50369086 1.0 µg

Wdr77 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Oas1e-set siRNA/shRNA/RNAi Lentivector (Mouse)
32390094 4x 500 ng

Oas1e-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
UBE2A (Ubiquitin-conjugating Enzyme E2 A, RAD6 Homolog A, RAD6A, HR6A, hHR6A, Ubiquitin Carrier Protein A, Ubiquitin-protein Ligase A) (AP)
MBS6134409-01 0.1 mL

UBE2A (Ubiquitin-conjugating Enzyme E2 A, RAD6 Homolog A, RAD6A, HR6A, hHR6A, Ubiquitin Carrier Protein A, Ubiquitin-protein Ligase A) (AP)

Sign In for Pricing
View Details
UBE2A (Ubiquitin-conjugating Enzyme E2 A, RAD6 Homolog A, RAD6A, HR6A, hHR6A, Ubiquitin Carrier Protein A, Ubiquitin-protein Ligase A) (AP)
MBS6134409-02 5x 0.1 mL

UBE2A (Ubiquitin-conjugating Enzyme E2 A, RAD6 Homolog A, RAD6A, HR6A, hHR6A, Ubiquitin Carrier Protein A, Ubiquitin-protein Ligase A) (AP)

Sign In for Pricing
View Details