Rat Gsta1 protein
This Rat Gsta1 protein spans the amino acid sequence from region 2-222aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
GST 1-1, GST 1a-1a, GST A1-1, GST B, Glutathione S-transferase Ya-1 , GST Ya1, Ligandin
UniProt
P00502
Expression Region
2-222aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Rattus norvegicus (Rat)
Field of Research
Signal Transduction
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
41.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full length of His-SUMO-tag and expression region is 2-222aa
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
037831-ML550 100 µL
LMBR1L, CT (LMBR1L, KIAA1174, LIMR, Protein LMBR1L, Limb region 1 protein homolog-like, Lipocalin-1-interacting membrane receptor) (MaxLight 550) discontinued
Sign In for Pricing
View Details 
LV756413 1.0 µg DNA
ZMYM2-IT1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 
abx330013-01 50 µg
Cellular Tumor Antigen p53 Phospho-Ser20 (TP53 pS20) Antibody
Sign In for Pricing
View Details abx330013-02 100 µg
Cellular Tumor Antigen p53 Phospho-Ser20 (TP53 pS20) Antibody
Sign In for Pricing
View Details