What is the catalog number for Rat Gsta1 protein?

The catalog number for Rat Gsta1 protein is orb358094.

What sizes are available for Rat Gsta1 protein?

Rat Gsta1 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Rat Gsta1 protein come in?

Rat Gsta1 protein is available in 3 different pack sizes.

Is Rat Gsta1 protein in stock?

Rat Gsta1 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Rat Gsta1 protein

This Rat Gsta1 protein spans the amino acid sequence from region 2-222aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GST 1-1, GST 1a-1a, GST A1-1, GST B, Glutathione S-transferase Ya-1 , GST Ya1, Ligandin

UniProt

P00502

Expression Region

2-222aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 2-222aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF