Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine CD8A protein

This Bovine CD8A protein spans the amino acid sequence from region 26-189aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD8a

UniProt

P31783

Expression Region

26-189aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Extracellular of His-SUMO-tag and expression region is 26-189aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LSFRMSPTQKETRLGEKVELQCELLQSGMATGCSWLRHIPGDDPRPTFLMYLSAQRVKLAEGLDPRHISGAKVSGTKFQLTLSSFLQEDQGYYFCSVVSNSILYFSNFVPVFLPAKPATTPAMRPSSAAPTSAPQTRSVSPRSEVCRTSAGSAVDTSRLDFACN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-NuMA (Thr2055) Peptide
AF2374-BP 1 mg

Phospho-NuMA (Thr2055) Peptide

Sign In for Pricing
View Details
Rat Rock2 (Rho-associated protein kinase 2) Quick ELISA Kit
orb2567506-01 48 Tests

Rat Rock2 (Rho-associated protein kinase 2) Quick ELISA Kit

Sign In for Pricing
View Details
Rat Rock2 (Rho-associated protein kinase 2) Quick ELISA Kit
orb2567506-02 96 Tests

Rat Rock2 (Rho-associated protein kinase 2) Quick ELISA Kit

Sign In for Pricing
View Details
Human TPP2 qPCR Primer Pair
QH24325S 200 Tests

Human TPP2 qPCR Primer Pair

Sign In for Pricing
View Details
ILKAP Polyclonal Antibody
orb1413340 100 µL

ILKAP Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Popdc2 qPCR Primer Pair
QM30542S 200 Tests

Mouse Popdc2 qPCR Primer Pair

Sign In for Pricing
View Details