Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Camk2n1 protein

This Mouse Camk2n1 protein spans the amino acid sequence from region 1-78aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Calcium/calmodulin-dependent protein kinase II inhibitor alpha , mCaMKIINalpha

UniProt

Q6QWF9

Expression Region

1-78aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-78aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQSKRPPKLGQIGRSKRVVIEDDRIDDVLKTMTDKAPPGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nucleolin Antibody [K8A13]
C15592-20uL 20 µL

Nucleolin Antibody [K8A13]

Sign In for Pricing
View Details
Lentiviral mouse Numbl shRNA (UAS) - Lentiviral mouse Numbl shRNA (UAS) (100)
GTR15170658 1 Vial

Lentiviral mouse Numbl shRNA (UAS) - Lentiviral mouse Numbl shRNA (UAS) (100)

Sign In for Pricing
View Details
Influenza A (A/Hubei/1/2011) NA (Active), His Tag
VAG170 10 µg

Influenza A (A/Hubei/1/2011) NA (Active), His Tag

Sign In for Pricing
View Details
SRP19 (G-1) FITC
sc-393775 FITC 200 µg/mL

SRP19 (G-1) FITC

Sign In for Pricing
View Details
Lentiviral human UTS2 shRNA (UAS) - Lentiviral human UTS2 shRNA (UAS) plasmid
GTR15344338 1 Vial

Lentiviral human UTS2 shRNA (UAS) - Lentiviral human UTS2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Rabbit Anti-PNPT1 antibody
SL7100R-01 50 µL

Rabbit Anti-PNPT1 antibody

Sign In for Pricing
View Details