Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Camk2n1 protein

This Mouse Camk2n1 protein spans the amino acid sequence from region 1-78aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Calcium/calmodulin-dependent protein kinase II inhibitor alpha , mCaMKIINalpha

UniProt

Q6QWF9

Expression Region

1-78aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 1-78aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQSKRPPKLGQIGRSKRVVIEDDRIDDVLKTMTDKAPPGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gfpt2 Rat shRNA Plasmid (Locus ID 360518)
TR700460 1 Kit

Gfpt2 Rat shRNA Plasmid (Locus ID 360518)

Sign In for Pricing
View Details
PGK1 Mouse
OM299136-01 25 µg

PGK1 Mouse

Sign In for Pricing
View Details
PGK1 Mouse
OM299136-02 5 µg

PGK1 Mouse

Sign In for Pricing
View Details
PGK1 Mouse
OM299136-03 1 mg

PGK1 Mouse

Sign In for Pricing
View Details
HMGN1 Antibody
25-080 100 µL

HMGN1 Antibody

Sign In for Pricing
View Details
Polyethylenimine, Linear, MW 2,500 (PEI 2500)
24313-2 2 g

Polyethylenimine, Linear, MW 2,500 (PEI 2500)

Sign In for Pricing
View Details