Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human C5 protein

This Human C5 protein spans the amino acid sequence from region 678-751aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4

UniProt

P01031

Expression Region

678-751aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of C5a anaphylatoxin chain of His-SUMO-tag and expression region is 678-751aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGFC siRNA (Mouse)
orb1844898-01 15 nmol

VEGFC siRNA (Mouse)

Sign In for Pricing
View Details
VEGFC siRNA (Mouse)
orb1844898-02 30 nmol

VEGFC siRNA (Mouse)

Sign In for Pricing
View Details
Rat Uba52 Pre-designed siRNA Set B
SI215482B 1 Each

Rat Uba52 Pre-designed siRNA Set B

Sign In for Pricing
View Details
IFluor® 350 Anti-human CD97 Antibody *MEM-180*
10970011-AAT 500 Tests

IFluor® 350 Anti-human CD97 Antibody *MEM-180*

Sign In for Pricing
View Details
AN30A Antibody
orb125422-01 25 µg

AN30A Antibody

Sign In for Pricing
View Details
AN30A Antibody
orb125422-02 50 µg

AN30A Antibody

Sign In for Pricing
View Details