Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BTN3A2 protein

This Human BTN3A2 protein spans the amino acid sequence from region 30-248aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BT3.2, BT3.3, BT3A2_HUMAN, BTF4, BTN3A 2, BTN3A2, Butyrophilin protein, Butyrophilin subfamily 3 member A2, Butyrophilin, subfamily 3, member A2, CD277, FLJ40011

UniProt

P78410

Expression Region

30-248aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Extracellular of His-SUMO-tag and expression region is 30-248aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC15A4 Rabbit Polyclonal Antibody
orb3128558 100 µg

SLC15A4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PCMV-HA-FLAG-Htr1f-Neo Plasmid
PVT63613 2 µg

PCMV-HA-FLAG-Htr1f-Neo Plasmid

Sign In for Pricing
View Details
Calreticulin Rabbit mAb
orb1922293-01 20 ul

Calreticulin Rabbit mAb

Sign In for Pricing
View Details
Calreticulin Rabbit mAb
orb1922293-02 50 µL

Calreticulin Rabbit mAb

Sign In for Pricing
View Details
Calreticulin Rabbit mAb
orb1922293-03 100 µL

Calreticulin Rabbit mAb

Sign In for Pricing
View Details
Lentiviral mouse Sowahb shRNA (UAS) - Lentiviral mouse Sowahb shRNA (UAS, RFP) (100)
GTR15265620 1 Vial

Lentiviral mouse Sowahb shRNA (UAS) - Lentiviral mouse Sowahb shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details