Human BTN3A2 protein
This Human BTN3A2 protein spans the amino acid sequence from region 30-248aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
BT3.2, BT3.3, BT3A2_HUMAN, BTF4, BTN3A 2, BTN3A2, Butyrophilin protein, Butyrophilin subfamily 3 member A2, Butyrophilin, subfamily 3, member A2, CD277, FLJ40011
UniProt
P78410
Expression Region
30-248aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
39.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full length of Extracellular of His-SUMO-tag and expression region is 30-248aa
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2887782 100 µL
Phospho-MARK2 (Ser595) Rabbit pAb, Pacific Blue conjugated
Sign In for Pricing
View Details 
orb2843747 100 µL
Oct-4B/OCT4B-190 Rabbit pAb, Pacific Blue conjugated
Sign In for Pricing
View Details 
AE20211HU-01 48 Tests
Human AKT-interacting protein (AKTIP) ELISA Kit
Sign In for Pricing
View Details AE20211HU-02 96 Tests
Human AKT-interacting protein (AKTIP) ELISA Kit
Sign In for Pricing
View Details