Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast CCL20 protein

This Yeast CCL20 protein spans the amino acid sequence from region 27-96aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CCL20

UniProt

Q8SQB1

Expression Region

27-96aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Bos taurus (Bovine)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASNFDCCLRYTERILHPSILVGFTQQLANEACDINAVVFYTRKKLAVCADPKKKWVKQVVHMLSQRVKRM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (GROEL/730), CF405S conjugate, 0.1mg/mL
BNC040730-100 1x 100 µL

HSP60 (GROEL/730), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2,6-Xylyl Phosphate
TRC-X747480-1G 1 g

2,6-Xylyl Phosphate

Sign In for Pricing
View Details
Human PDGF-AB (Platelet Derived Growth Factor AB) ELISA Kit
E-EL-H1576-01 24 Tests

Human PDGF-AB (Platelet Derived Growth Factor AB) ELISA Kit

Sign In for Pricing
View Details
Human PDGF-AB (Platelet Derived Growth Factor AB) ELISA Kit
E-EL-H1576-02 48 Tests

Human PDGF-AB (Platelet Derived Growth Factor AB) ELISA Kit

Sign In for Pricing
View Details
Human PDGF-AB (Platelet Derived Growth Factor AB) ELISA Kit
E-EL-H1576-03 96 Tests

Human PDGF-AB (Platelet Derived Growth Factor AB) ELISA Kit

Sign In for Pricing
View Details
CaMK2α/δ (Ab-286) Antibody
8B7033-AAT 50 µg

CaMK2α/δ (Ab-286) Antibody

Sign In for Pricing
View Details