Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast CCL20 protein

This Yeast CCL20 protein spans the amino acid sequence from region 27-96aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CCL20

UniProt

Q8SQB1

Expression Region

27-96aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Bos taurus (Bovine)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASNFDCCLRYTERILHPSILVGFTQQLANEACDINAVVFYTRKKLAVCADPKKKWVKQVVHMLSQRVKRM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L3Nie.01 Antibody
CSB-PA4964XA01GLF-01 50 μL

L3Nie.01 Antibody

Sign In for Pricing
View Details
L3Nie.01 Antibody
CSB-PA4964XA01GLF-02 100 µL

L3Nie.01 Antibody

Sign In for Pricing
View Details
HID1 Conjugated Antibody
orb1620549 100 µL

HID1 Conjugated Antibody

Sign In for Pricing
View Details
Ubiquityl-Histone H2B (Lys120) Rabbit mAb
C05193-01 20 µL

Ubiquityl-Histone H2B (Lys120) Rabbit mAb

Sign In for Pricing
View Details
Ubiquityl-Histone H2B (Lys120) Rabbit mAb
C05193-02 100 µL

Ubiquityl-Histone H2B (Lys120) Rabbit mAb

Sign In for Pricing
View Details
Ubiquityl-Histone H2B (Lys120) Rabbit mAb
C05193-03 2x 100 μL

Ubiquityl-Histone H2B (Lys120) Rabbit mAb

Sign In for Pricing
View Details