Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Serpina3n protein

This Mouse Serpina3n protein spans the amino acid sequence from region 21-418aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Serpina3n

UniProt

Q91WP6

Expression Region

21-418aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics, Immunology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFSISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

His-Tag Polyclonal Antibody
APRab80011-01 50 µL

His-Tag Polyclonal Antibody

Sign In for Pricing
View Details
His-Tag Polyclonal Antibody
APRab80011-02 100 µL

His-Tag Polyclonal Antibody

Sign In for Pricing
View Details
C19orf38 Protein Vector (Human) (pPB-C-His)
PV065993 500 ng

C19orf38 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Purified anti-mouse CD206 (MMR) Recombinant
GT06182 100 µg

Purified anti-mouse CD206 (MMR) Recombinant

Sign In for Pricing
View Details
Mouse Monoclonal CD31/PECAM-1 Antibody (rPECAM1/8829) [Janelia Fluor 646]
NBP3-23988JF646 0.1 mL

Mouse Monoclonal CD31/PECAM-1 Antibody (rPECAM1/8829) [Janelia Fluor 646]

Sign In for Pricing
View Details
Others Antibody
orb3169727-01 1 mg

Others Antibody

Sign In for Pricing
View Details