Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IGLL5 protein

This Human IGLL5 protein spans the amino acid sequence from region 36-214aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IGLL5

UniProt

B9A064

Expression Region

36-214aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HGLLRPMVAPQSGDPDPGASVGSSRSSLRSLWGRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fetuin A (AHSG) (NM_001622) Human Recombinant Protein
TP308344M 100 µg

Fetuin A (AHSG) (NM_001622) Human Recombinant Protein

Sign In for Pricing
View Details
Arachidonic Acid (AA) Polyclonal Antibody
CAU26509-01 100 µL

Arachidonic Acid (AA) Polyclonal Antibody

Sign In for Pricing
View Details
Arachidonic Acid (AA) Polyclonal Antibody
CAU26509-02 200 µL

Arachidonic Acid (AA) Polyclonal Antibody

Sign In for Pricing
View Details
CART (CARTPT) (NM_004291) Human Recombinant Protein
PROTQ16568 20 µg

CART (CARTPT) (NM_004291) Human Recombinant Protein

Sign In for Pricing
View Details
AF 488 tetrazine, 5-isomer, 100 mg
618E0 100 mg

AF 488 tetrazine, 5-isomer, 100 mg

Sign In for Pricing
View Details
Rabbit Polyclonal BOLA1 Antibody [PE]
NBP2-99968PE 0.1 mL

Rabbit Polyclonal BOLA1 Antibody [PE]

Sign In for Pricing
View Details