Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IGLL5 protein

This Human IGLL5 protein spans the amino acid sequence from region 36-214aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IGLL5

UniProt

B9A064

Expression Region

36-214aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HGLLRPMVAPQSGDPDPGASVGSSRSSLRSLWGRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,6-Dibromo-4-fluorophenyl isocyanate
sc-231154 2 g

2,6-Dibromo-4-fluorophenyl isocyanate

Sign In for Pricing
View Details
Manbal sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7493605 3x 1.0 µg

Manbal sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Anti-Alpha-Synuclein Antibody (1Q928)
TMAY-02234-01 20 µL

Anti-Alpha-Synuclein Antibody (1Q928)

Sign In for Pricing
View Details
Anti-Alpha-Synuclein Antibody (1Q928)
TMAY-02234-02 100 µL

Anti-Alpha-Synuclein Antibody (1Q928)

Sign In for Pricing
View Details
KIF3A Rabbit pAb
orb2719271-01 50 µL

KIF3A Rabbit pAb

Sign In for Pricing
View Details
KIF3A Rabbit pAb
orb2719271-02 100 µL

KIF3A Rabbit pAb

Sign In for Pricing
View Details