Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IGLL5 protein

This Human IGLL5 protein spans the amino acid sequence from region 36-214aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IGLL5

UniProt

B9A064

Expression Region

36-214aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HGLLRPMVAPQSGDPDPGASVGSSRSSLRSLWGRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR1D1 (Nuclear Receptor Subfamily 1, Group D, Member 1, EAR1, THRA1, THRAL, ear-1, hRev) (MaxLight 405) discontinued
249442-ML405 100 µL

NR1D1 (Nuclear Receptor Subfamily 1, Group D, Member 1, EAR1, THRA1, THRAL, ear-1, hRev) (MaxLight 405) discontinued

Sign In for Pricing
View Details
HDAC1, CT (HDAC1, RPD3L1, Histone deacetylase 1) (MaxLight 490) discontinued
036473-ML490 100 µL

HDAC1, CT (HDAC1, RPD3L1, Histone deacetylase 1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
C16orf48 Rabbit Polyclonal Antibody (FITC)
orb2110734 100 µL

C16orf48 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Patl1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6666003 1.0 µg DNA

Patl1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
hsa-miR-4717-3p miRNA Mimic
MBS8299610-01 5 nmol

hsa-miR-4717-3p miRNA Mimic

Sign In for Pricing
View Details
hsa-miR-4717-3p miRNA Mimic
MBS8299610-02 10 nmol

hsa-miR-4717-3p miRNA Mimic

Sign In for Pricing
View Details