Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast G protein

This Yeast G protein spans the amino acid sequence from region 20-459aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

G

UniProt

A3RM22

Expression Region

20-459aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rabies virus (strain PM) (RABV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVKTTKESLVIISPSVADLDPYDKSLHSRVFPSGKCSGITISSTYCSTNHDYTIWMPENPRLGTSCDIFTNSRGKRASKGGKTCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDQLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMATKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLRVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQHMELLESSVIPLMHPLADPSTVFKDGDEAEDFVEVHLPDVHKQISGVDLGLPSWGKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Catalase (CAT) Activity Assay Kit
MBS7620842-01 100 Tests

Catalase (CAT) Activity Assay Kit

Sign In for Pricing
View Details
Catalase (CAT) Activity Assay Kit
MBS7620842-02 5x 100 Tests

Catalase (CAT) Activity Assay Kit

Sign In for Pricing
View Details
RFP Mouse mAb, PerCP-Cy7 conjugated
orb3125788 100 µL

RFP Mouse mAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
KCNN2 Rabbit Polyclonal Antibody (Biotin)
orb2133470 100 µL

KCNN2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
NEK8 Antibody
MBS9606826-01 0.1 mL

NEK8 Antibody

Sign In for Pricing
View Details
NEK8 Antibody
MBS9606826-02 0.2 mL

NEK8 Antibody

Sign In for Pricing
View Details