Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast phyA protein

This Yeast phyA protein spans the amino acid sequence from region 24-467aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PhyA

UniProt

P34752

Expression Region

24-467aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Aspergillus niger

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASRNQSSCDTVDQGYQCFSETSHLWGQYAPFFSLANESVISPEVPAGCRVTFAQVLSRHGARYPTDSKGKKYSALIEEIQQNATTFDGKYAFLKTYNYSLGADDLTPFGEQELVNSGIKFYQRYESLTRNIVPFIRSSGSSRVIASGKKFIEGFQSTKLKDPRAQPGQSSPKIDVVISEASSSNNTLDPGTCTVFEDSELADTVEANFTATFVPSIRQRLENDLSGVTLTDTEVTYLMDMCSFDTISTSTVDTKLSPFCDLFTHDEWINYDYLQSLKKYYGHGAGNPLGPTQGVGYANELIARLTHSPVHDDTSSNHTLDSSPATFPLNSTLYADFSHDNGIISILFALGLYNGTKPLSTTTVENITQTDGFSSAWTVPFASRLYVEMMQCQAEQEPLVRVLVNDRVVPLHGCPVDALGRCTRDSFVRGLSFARSGGDWAECFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED16 Rabbit Polyclonal Antibody (Biotin)
orb2143277 100 µL

MED16 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
NNMT, ID (NNMT, Nicotinamide N-methyltransferase)
039036 200 µL

NNMT, ID (NNMT, Nicotinamide N-methyltransferase)

Sign In for Pricing
View Details
Tulathromycin Impurity 27
RM-T211227-01 10 mg

Tulathromycin Impurity 27

Sign In for Pricing
View Details
Tulathromycin Impurity 27
RM-T211227-02 25 mg

Tulathromycin Impurity 27

Sign In for Pricing
View Details
Tulathromycin Impurity 27
RM-T211227-03 50 mg

Tulathromycin Impurity 27

Sign In for Pricing
View Details
Tulathromycin Impurity 27
RM-T211227-04 100 mg

Tulathromycin Impurity 27

Sign In for Pricing
View Details