Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast TGFA protein

This Yeast TGFA protein spans the amino acid sequence from region 24-97aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TGFA

UniProt

P98135

Expression Region

24-97aa

Tag

N-terminal GST-tagged

Source

Yeast

Origin

Ovis aries (Sheep)

Field of Research

Infectious Disease & Virology; Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ENSTSALSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLLQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Pctp shRNA (UAS) - Lentiviral mouse Pctp shRNA (UAS, iRFP) (100)
GTR15272151 1 Vial

Lentiviral mouse Pctp shRNA (UAS) - Lentiviral mouse Pctp shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
RfaH Antibody
orb825554 2 mg

RfaH Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal GW182 Antibody [Alexa Fluor 647]
NBP1-28702AF647 0.1 mL

Rabbit Polyclonal GW182 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
IGFBP4 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-10585R-BF405 100 µL

IGFBP4 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Mouse Mir5118 qPCR Primer Pair
QM80030S 200 Tests

Mouse Mir5118 qPCR Primer Pair

Sign In for Pricing
View Details
Anti-Calothrix sp. NIES-2098 NIES2098_06580 Antibody-FITC Conjugate
DZ41609-FITC 200 µL/Vial

Anti-Calothrix sp. NIES-2098 NIES2098_06580 Antibody-FITC Conjugate

Sign In for Pricing
View Details