Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast TGFA protein

This Yeast TGFA protein spans the amino acid sequence from region 24-97aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TGFA

UniProt

P98135

Expression Region

24-97aa

Tag

N-terminal GST-tagged

Source

Yeast

Origin

Ovis aries (Sheep)

Field of Research

Infectious Disease & Virology; Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ENSTSALSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLLQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFSF10 Recombinant Protein (Human)
OPCA00705-1MG 1 mg

TNFSF10 Recombinant Protein (Human)

Sign In for Pricing
View Details
TMEM16A (ANO1) Mouse Monoclonal Antibody [Clone ID: OTI3A3]
CF803590 100 µg

TMEM16A (ANO1) Mouse Monoclonal Antibody [Clone ID: OTI3A3]

Sign In for Pricing
View Details
OR10A3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
34859111 3x 1.0 µg

OR10A3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Cytochrome C (CYCS) Human qPCR Primer Pair (NM_018947)
HP213290 200 Reactions

Cytochrome C (CYCS) Human qPCR Primer Pair (NM_018947)

Sign In for Pricing
View Details
SA (Sialic Acid) ELISA Kit
EK250368 96 Well

SA (Sialic Acid) ELISA Kit

Sign In for Pricing
View Details
Aggrecan (Proteoglycan, PG, AGC 1, Aggrecan 1, Antigen identified by monoclonal A0122, Cartilage specific proteoglycan core protein, Chondroitin sulfate proteoglycan core protein 1, CSPCP, CSPG1, CSPGCP, Large aggregating proteoglycan, MSK16, SEDK) (FITC) discontinued
A1059-53C-FITC 100 µL

Aggrecan (Proteoglycan, PG, AGC 1, Aggrecan 1, Antigen identified by monoclonal A0122, Cartilage specific proteoglycan core protein, Chondroitin sulfate proteoglycan core protein 1, CSPCP, CSPG1, CSPGCP, Large aggregating proteoglycan, MSK16, SEDK) (FITC) discontinued

Sign In for Pricing
View Details