Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast TGFA protein

This Yeast TGFA protein spans the amino acid sequence from region 24-97aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TGFA

UniProt

P98135

Expression Region

24-97aa

Tag

N-terminal GST-tagged

Source

Yeast

Origin

Ovis aries (Sheep)

Field of Research

Infectious Disease & Virology; Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ENSTSALSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLLQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ptges2 shRNA (UAS) - Lentiviral mouse Ptges2 shRNA (UAS, iRFP) (100)
GTR15260031 1 Vial

Lentiviral mouse Ptges2 shRNA (UAS) - Lentiviral mouse Ptges2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
RGD1559690 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6551804 1.0 µg DNA

RGD1559690 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
SPINK1 ELISA Kit (Human) (OKBB00557)
OKBB00557 96 Well

SPINK1 ELISA Kit (Human) (OKBB00557)

Sign In for Pricing
View Details
GREM2 (NM_022469) Human Tagged ORF Clone
RG207388 10 µg

GREM2 (NM_022469) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human FAM19A2 protein
ARP8634-01 10 µg

Recombinant Human FAM19A2 protein

Sign In for Pricing
View Details
Recombinant Human FAM19A2 protein
ARP8634-02 50 µg

Recombinant Human FAM19A2 protein

Sign In for Pricing
View Details