Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast TGFA protein

This Yeast TGFA protein spans the amino acid sequence from region 24-97aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TGFA

UniProt

P98135

Expression Region

24-97aa

Tag

N-terminal GST-tagged

Source

Yeast

Origin

Ovis aries (Sheep)

Field of Research

Infectious Disease & Virology; Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ENSTSALSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLLQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Shaker Polyclonal Antibody
OAAI00625-100UG 100 µg

Anti-Shaker Polyclonal Antibody

Sign In for Pricing
View Details
Chicken PDGF-BB (Platelet Derived Growth Factor-BB) ELISA Kit
MBS2513232-01 24 Tests

Chicken PDGF-BB (Platelet Derived Growth Factor-BB) ELISA Kit

Sign In for Pricing
View Details
Chicken PDGF-BB (Platelet Derived Growth Factor-BB) ELISA Kit
MBS2513232-02 48 Tests

Chicken PDGF-BB (Platelet Derived Growth Factor-BB) ELISA Kit

Sign In for Pricing
View Details
Chicken PDGF-BB (Platelet Derived Growth Factor-BB) ELISA Kit
MBS2513232-03 96 Tests

Chicken PDGF-BB (Platelet Derived Growth Factor-BB) ELISA Kit

Sign In for Pricing
View Details
Chicken PDGF-BB (Platelet Derived Growth Factor-BB) ELISA Kit
MBS2513232-04 5x 96 Tests

Chicken PDGF-BB (Platelet Derived Growth Factor-BB) ELISA Kit

Sign In for Pricing
View Details
Chicken PDGF-BB (Platelet Derived Growth Factor-BB) ELISA Kit
MBS2513232-05 10x 96 Tests

Chicken PDGF-BB (Platelet Derived Growth Factor-BB) ELISA Kit

Sign In for Pricing
View Details