Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human P26678 protein

This Human P26678 protein spans the amino acid sequence from region 1-52aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P26678

UniProt

P26678

Expression Region

1-52aa

Tag

N-terminal GST-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-FKLF antibody
SL16096R-01 50 µL

Rabbit Anti-FKLF antibody

Sign In for Pricing
View Details
Rabbit Anti-FKLF antibody
SL16096R-02 100 µL

Rabbit Anti-FKLF antibody

Sign In for Pricing
View Details
Posaconazole - Bio-X TM
BP164281 10 mg

Posaconazole - Bio-X TM

Sign In for Pricing
View Details
Sil Double Nickase Plasmid (h)
sc-409193-NIC 20 µg

Sil Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Recombinant Corynebacterium Diphtheriae metK Protein (aa 1-410)
VAng-Lsx2891-1mgEcoli 1 mg (E. coli)

Recombinant Corynebacterium Diphtheriae metK Protein (aa 1-410)

Sign In for Pricing
View Details
AAS Release Agent 1.0% Lanthanum in HCl
RA1CO5 500 mL

AAS Release Agent 1.0% Lanthanum in HCl

Sign In for Pricing
View Details