Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human P26678 protein

This Human P26678 protein spans the amino acid sequence from region 1-52aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P26678

UniProt

P26678

Expression Region

1-52aa

Tag

N-terminal GST-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAR1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-0828R-BF594-01 20 µL

PAR1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
PAR1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-0828R-BF594-02 100 µL

PAR1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
MED23 siRNA (Human)
orb1862000-01 15 nmol

MED23 siRNA (Human)

Sign In for Pricing
View Details
MED23 siRNA (Human)
orb1862000-02 30 nmol

MED23 siRNA (Human)

Sign In for Pricing
View Details
PABPC1L2A CytoSection
TS415091P5 25 Slides

PABPC1L2A CytoSection

Sign In for Pricing
View Details
Chicken Polyclonal CDC42 Antibody [Alexa Fluor 700]
NBP1-76330AF700 0.1 mL

Chicken Polyclonal CDC42 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details