Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast IL1 alpha protein

This Yeast IL1 alpha protein spans the amino acid sequence from region 113-271aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hematopoietin 1 protein, Hematopoietin-1 protein, IL 1 alpha protein, IL 1 protein, IL 1A protein, IL-1 alpha protein, Il-1a protein, IL1 ALPHA protein, IL1 protein, IL1A protein, IL1A_HUMAN protein, IL1F1 protein, ilia protein, Interleukin 1 alpha protein, Interleukin 1 alpha precursor protein, Interleukin-1 alpha protein, Interleukin1 alpha protein, Preinterleukin 1 alpha protein, Pro interleukin 1 alpha protein

UniProt

P48089

Expression Region

113-271aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQHLTAAAIHNLDEAVKFDMGAYTSSKDDTKVPVILRISKTQLYVSAQDEDQPVLLKEMPEINKTITGSETNFLFFWETHGTKNYFISVAHPNLFIATKHDNWVCLAKGLPSITDFQILENQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHX30 Antibody, HRP conjugated
MBS1494405-01 0.05 mg

DHX30 Antibody, HRP conjugated

Sign In for Pricing
View Details
DHX30 Antibody, HRP conjugated
MBS1494405-02 0.1 mg

DHX30 Antibody, HRP conjugated

Sign In for Pricing
View Details
DHX30 Antibody, HRP conjugated
MBS1494405-03 5x 0.1 mg

DHX30 Antibody, HRP conjugated

Sign In for Pricing
View Details
OASL Antibody
CSB-PA925792-01 50 μL

OASL Antibody

Sign In for Pricing
View Details
OASL Antibody
CSB-PA925792-02 100 µL

OASL Antibody

Sign In for Pricing
View Details
Human hsa-miR-1252-3p miRNA Antagomir
abx887347-01 10 nmol

Human hsa-miR-1252-3p miRNA Antagomir

Sign In for Pricing
View Details