Yeast IL15 protein
This Yeast IL15 protein spans the amino acid sequence from region 49-162aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
IL15
UniProt
P48092
Expression Region
49-162aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Macaca mulatta (Rhesus macaque)
Field of Research
Infectious Disease & Virology; Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
14.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISHESGDTDIHDTVENLIILANNILSSNGNITESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A02372S455-1 100 µL
Anti-Phospho-ATP-citrate synthase (S455) ACLY Antibody
Sign In for Pricing
View Details 042887-ML490 100 µL
TM117, CT (TMEM117, Transmembrane protein 117) (MaxLight 490) discontinued
Sign In for Pricing
View Details 
MBS9348959-01 48 Well
Rat Phosducin-Like Protein 3 (PDCL3) ELISA Kit
Sign In for Pricing
View Details MBS9348959-02 96 Well
Rat Phosducin-Like Protein 3 (PDCL3) ELISA Kit
Sign In for Pricing
View Details MBS9348959-03 5x 96 Well
Rat Phosducin-Like Protein 3 (PDCL3) ELISA Kit
Sign In for Pricing
View Details MBS9348959-04 10x 96 Well
Rat Phosducin-Like Protein 3 (PDCL3) ELISA Kit
Sign In for Pricing
View Details