Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Cela2a protein

This Mouse Cela2a protein spans the amino acid sequence from region 31-271aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cela2a

UniProt

P05208

Expression Region

31-271aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF571 Protein Vector (Human) (pPM-C-HA)
PV060311 500 ng

ZNF571 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
CB1 inverse agonist 1
M32826-01 1 g

CB1 inverse agonist 1

Sign In for Pricing
View Details
CB1 inverse agonist 1
M32826-02 500 mg

CB1 inverse agonist 1

Sign In for Pricing
View Details
CB1 inverse agonist 1
M32826-03 5 mg

CB1 inverse agonist 1

Sign In for Pricing
View Details
CB1 inverse agonist 1
M32826-04 10 mg

CB1 inverse agonist 1

Sign In for Pricing
View Details
CB1 inverse agonist 1
M32826-05 25 mg

CB1 inverse agonist 1

Sign In for Pricing
View Details