Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ATP5D protein

This Human ATP5D protein spans the amino acid sequence from region 23-168aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATP5D

UniProt

P30049

Expression Region

23-168aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal PSGL-1/CD162 Antibody (688101) [PE/Cy5.5]
FAB9961PECY55 0.1 mL

Mouse Monoclonal PSGL-1/CD162 Antibody (688101) [PE/Cy5.5]

Sign In for Pricing
View Details
Recombinant Human SARS coronavirus Spike glycoprotein (S), partial
MBS7137000-01 0.02 mg (Yeast)

Recombinant Human SARS coronavirus Spike glycoprotein (S), partial

Sign In for Pricing
View Details
Recombinant Human SARS coronavirus Spike glycoprotein (S), partial
MBS7137000-02 0.1 mg (Yeast)

Recombinant Human SARS coronavirus Spike glycoprotein (S), partial

Sign In for Pricing
View Details
Recombinant Human SARS coronavirus Spike glycoprotein (S), partial
MBS7137000-03 1 mg (Yeast)

Recombinant Human SARS coronavirus Spike glycoprotein (S), partial

Sign In for Pricing
View Details
Recombinant Human SARS coronavirus Spike glycoprotein (S), partial
MBS7137000-04 5x 1 mg (Yeast)

Recombinant Human SARS coronavirus Spike glycoprotein (S), partial

Sign In for Pricing
View Details
NCOR2 Polyclonal Antibody, Biotin Conjugated
bs-1420R-Biotin 100 µL

NCOR2 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details