Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Aif1 protein

This Rat Aif1 protein spans the amino acid sequence from region 2-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aif1

UniProt

P55009

Expression Region

2-147aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SQSKDLQGGKAFGLLKAQQEERLDGINKHFLDDPKYSSDEDLQSKLEAFKTKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHQKPTGPPAKKAISELP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Zbtb38 shRNA (UAS) - Lentiviral mouse Zbtb38 shRNA (UAS, iRFP) (100)
GTR15201771 1 Vial

Lentiviral mouse Zbtb38 shRNA (UAS) - Lentiviral mouse Zbtb38 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Anti-GDI1 Antibody
A04179-2 100 µg/Vial

Anti-GDI1 Antibody

Sign In for Pricing
View Details
p16 Polyclonal Antibody
MBS8524474-01 0.1 mg

p16 Polyclonal Antibody

Sign In for Pricing
View Details
p16 Polyclonal Antibody
MBS8524474-02 0.1 mL (AF635)

p16 Polyclonal Antibody

Sign In for Pricing
View Details
p16 Polyclonal Antibody
MBS8524474-03 0.1 mL (AF610)

p16 Polyclonal Antibody

Sign In for Pricing
View Details
p16 Polyclonal Antibody
MBS8524474-04 0.1 mL (AF405S)

p16 Polyclonal Antibody

Sign In for Pricing
View Details