Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Aif1 protein

This Rat Aif1 protein spans the amino acid sequence from region 2-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aif1

UniProt

P55009

Expression Region

2-147aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SQSKDLQGGKAFGLLKAQQEERLDGINKHFLDDPKYSSDEDLQSKLEAFKTKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHQKPTGPPAKKAISELP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diethyl [ (2,6-dimethylphenyl) methyl]phosphonate
CLB52655-01 50 mg

Diethyl [ (2,6-dimethylphenyl) methyl]phosphonate

Sign In for Pricing
View Details
Diethyl [ (2,6-dimethylphenyl) methyl]phosphonate
CLB52655-02 0.5 g

Diethyl [ (2,6-dimethylphenyl) methyl]phosphonate

Sign In for Pricing
View Details
TRAF6 discontinued
531972-01 20 µL

TRAF6 discontinued

Sign In for Pricing
View Details
TRAF6 discontinued
531972-02 100 µL

TRAF6 discontinued

Sign In for Pricing
View Details
RNF165 Blocking Peptide
33R-6596 0.1 mg

RNF165 Blocking Peptide

Sign In for Pricing
View Details
Polyclonal Antibody to Glypican 5 (GPC5)
TRV-0003623-01 20 µL

Polyclonal Antibody to Glypican 5 (GPC5)

Sign In for Pricing
View Details