Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human beta 1 Adrenergic Receptor protein

This Human beta 1 Adrenergic Receptor protein spans the amino acid sequence from region 378-477aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ADR B1 protein, ADRB 1 protein, ADRB1 protein, ADRB1R protein, Adrenergic beta 1 receptor protein, Adrenoceptor beta 1 protein, B1AR protein, Beta 1 adrenoceptor protein, Beta 1 adrenoreceptor protein, Beta-1 adrenergic receptor protein, Beta-1 adrenoceptor protein, Beta-1 adrenoreceptor protein, BETA1AR protein, RHR protein

UniProt

P08588

Expression Region

378-477aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gpr68 (NM_175493) Mouse Untagged Clone
MC213052 10 µg

Gpr68 (NM_175493) Mouse Untagged Clone

Sign In for Pricing
View Details
CK5+CK6 Polyclonal Antibody, Biotin Conjugated
bs-20824R-Biotin 100 µL

CK5+CK6 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Anti-Amyloid Alpha Antibody (Birtamimab)
F1531-5 5 mg

Anti-Amyloid Alpha Antibody (Birtamimab)

Sign In for Pricing
View Details
Z-Thr (tBu) -OH · DCHA
4001246.0005 5 g

Z-Thr (tBu) -OH · DCHA

Sign In for Pricing
View Details
Histone H2B Mouse Monoclonal Antibody (Cy5)
orb969288 100 µL

Histone H2B Mouse Monoclonal Antibody (Cy5)

Sign In for Pricing
View Details
Pancreatic Lipase Related Protein 2 (PNLIPRP2) (NM_005396) Human Tagged ORF Clone Lentiviral Particle
RC221745L4V 200 µL

Pancreatic Lipase Related Protein 2 (PNLIPRP2) (NM_005396) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details