Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LY6E protein

This Human LY6E protein spans the amino acid sequence from region 21-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LY6E

UniProt

Q16553

Expression Region

21-101aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose

AA Sequence

LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Rnf103 Pre-designed siRNA Set A
SI112061A 1 Each

Mouse Rnf103 Pre-designed siRNA Set A

Sign In for Pricing
View Details
MAPK7 Rabbit Monoclonal Antibody
E46F2319 40 µL

MAPK7 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Map2k7, ID (Map2k7, Mkk7, Dual specificity mitogen-activated protein kinase kinase 7, JNK-activating kinase 2, MAPK/ERK kinase 7, c-Jun N-terminal kinase kinase 2) (MaxLight 550) discontinued
038135-ML550 100 µL

Map2k7, ID (Map2k7, Mkk7, Dual specificity mitogen-activated protein kinase kinase 7, JNK-activating kinase 2, MAPK/ERK kinase 7, c-Jun N-terminal kinase kinase 2) (MaxLight 550) discontinued

Sign In for Pricing
View Details
APNG (D-2) Alexa Fluor® 790
sc-390684 AF790 200 µg/mL

APNG (D-2) Alexa Fluor® 790

Sign In for Pricing
View Details
Mcpt4 ORF Vector (Rat) (pORF)
28247016 1.0 µg DNA

Mcpt4 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Porcine Transcription factor BTF3 homolog 4 (BTF3L4) ELISA Kit
MBS7229114-01 48 Well

Porcine Transcription factor BTF3 homolog 4 (BTF3L4) ELISA Kit

Sign In for Pricing
View Details