Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LY6E protein

This Human LY6E protein spans the amino acid sequence from region 21-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LY6E

UniProt

Q16553

Expression Region

21-101aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose

AA Sequence

LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC6 Protein Lysate (Rat) with C-HA Tag
27690036 100 µg

LRRC6 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
6,7-Dichloroquinoxaline-2,3 (1H,4H) -dione
sc-325963 1 g

6,7-Dichloroquinoxaline-2,3 (1H,4H) -dione

Sign In for Pricing
View Details
FBXO46 (NM_001080469) Human Tagged ORF Clone
RC223669 10 µg

FBXO46 (NM_001080469) Human Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral human STARD5 shRNA (UAS) - Lentiviral human STARD5 shRNA (UAS, RFP) (25)
GTR15330590 1 Vial

Lentiviral human STARD5 shRNA (UAS) - Lentiviral human STARD5 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Ficolin 3 (FCN3) Magnetic Luminex Assay Kit
LKU602432 96 Tests

Ficolin 3 (FCN3) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
Gm5134 Protein Vector (Mouse) (pPM-C-HA)
22076024 500 ng

Gm5134 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details