Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LY6E protein

This Human LY6E protein spans the amino acid sequence from region 21-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LY6E

UniProt

Q16553

Expression Region

21-101aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose

AA Sequence

LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGD Polyclonal Antibody
BT-AP07097-01 20 µL

PGD Polyclonal Antibody

Sign In for Pricing
View Details
PGD Polyclonal Antibody
BT-AP07097-02 50 µL

PGD Polyclonal Antibody

Sign In for Pricing
View Details
PGD Polyclonal Antibody
BT-AP07097-03 100 µL

PGD Polyclonal Antibody

Sign In for Pricing
View Details
GFP Expressing Monkey Primary Prostate Epithelial Cells
NHFF-1123-HX238 Each

GFP Expressing Monkey Primary Prostate Epithelial Cells

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial
MBS1117905-01 1 mg (E-Coli)

Recombinant Haemophilus influenzae Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial
MBS1117905-02 1 mg (Yeast)

Recombinant Haemophilus influenzae Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial

Sign In for Pricing
View Details