Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast SNCA protein

This Yeast SNCA protein spans the amino acid sequence from region 1-140aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SNCA

UniProt

P61142

Expression Region

1-140aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFIKKDQLGKNEEGAPQEGILQDMPVDPDNEAYEMPSEEGYQDYEPEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium avium DNA ligase (ligA), partial
MBS1065812 Inquire

Recombinant Mycobacterium avium DNA ligase (ligA), partial

Sign In for Pricing
View Details
UGT2B17 AAV siRNA Pooled Vector
49132161 1.0 µg

UGT2B17 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Human TGFB3 Protein, hFc Tag
MBS188509-01 0.01 mg

Human TGFB3 Protein, hFc Tag

Sign In for Pricing
View Details
Human TGFB3 Protein, hFc Tag
MBS188509-02 0.05 mg

Human TGFB3 Protein, hFc Tag

Sign In for Pricing
View Details
Human TGFB3 Protein, hFc Tag
MBS188509-03 0.1 mg

Human TGFB3 Protein, hFc Tag

Sign In for Pricing
View Details
Human TGFB3 Protein, hFc Tag
MBS188509-04 5x 0.1 mg

Human TGFB3 Protein, hFc Tag

Sign In for Pricing
View Details