Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Reg3g protein

This Mouse Reg3g protein spans the amino acid sequence from region 27-174aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Reg3g

UniProt

O09049

Expression Region

27-174aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EVAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNWYDADMACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDPTLGYEPNRGGWEWSNADVMNYINWETNPSSSSGNHCGTLSRASGFLKWRENYCNLELPYVCKFKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-3912-3p miRNA Antagomir
MBS8317122-01 10 nmol

hsa-miR-3912-3p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-3912-3p miRNA Antagomir
MBS8317122-02 20 nmol

hsa-miR-3912-3p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-3912-3p miRNA Antagomir
MBS8317122-03 5x 20 nmol

hsa-miR-3912-3p miRNA Antagomir

Sign In for Pricing
View Details
Klp2 Antibody
orb854767 2 mg

Klp2 Antibody

Sign In for Pricing
View Details
SERCA1 ATPase Rabbit Monoclonal Antibody
orb866534 100 µL

SERCA1 ATPase Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Thioredoxin 2/TXN2 Antibody Picoband® (monoclonal, 7B5) Fluoro594 Conjugated
M04586-1-Fluoro594 100 µg/Vial

Anti-Thioredoxin 2/TXN2 Antibody Picoband® (monoclonal, 7B5) Fluoro594 Conjugated

Sign In for Pricing
View Details