Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SMARCC1 protein

This Human SMARCC1 protein spans the amino acid sequence from region 451-671aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BRG1-associated factor 155 , BAF155SWI/SNF complex 155KDA subunitSWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1

UniProt

Q92922

Expression Region

451-671aa

Tag

N-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

SWIRM&SANT domain of His-tag and expression region is 449-669aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVDPESRPMAMGPPPTPHFNVLADTPSGLVPLHLRSPQVPAAQQMLNFPEKNKEKPVDLQNFGLRTDIYSKKTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Saitohin ELISA Kit
OM621049 96 Strip Well

Sheep Saitohin ELISA Kit

Sign In for Pricing
View Details
H-Gly-Gly-Ile-OH
H-3430.0005 5.0g

H-Gly-Gly-Ile-OH

Sign In for Pricing
View Details
SH2B1 Polyclonal Antibody
E-AB-61018-01 60 µL

SH2B1 Polyclonal Antibody

Sign In for Pricing
View Details
SH2B1 Polyclonal Antibody
E-AB-61018-02 120 µL

SH2B1 Polyclonal Antibody

Sign In for Pricing
View Details
SH2B1 Polyclonal Antibody
E-AB-61018-03 200 µL

SH2B1 Polyclonal Antibody

Sign In for Pricing
View Details
DNA2 Protein Vector (Mouse) (pPB-C-His)
PV172530 500 ng

DNA2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details