Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Plbd2 protein

This Mouse Plbd2 protein spans the amino acid sequence from region 47-594aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

66.3KDA protein76KDA protein , p76LAMA-like protein 2Lamina ancestor homolog 2, Phospholipase B domain-containing protein 2

UniProt

Q3TCN2

Expression Region

47-594aa

Tag

N-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

65.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length protein of HIS and expression region is 47-594aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPTLGPGWQRQNPDPPVSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTNTKPSLGSGSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLVAGNNLVFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNVVANRLALDGATWADVFKRFNSGTYNNQWMIVDYKAFLPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFETVFNASGLQALVAQYGDWFSYTKNPRAKIFQRDQSLVEDMDAMVRLMRYNDFLHDPLSLCEACNPKPNAENAISARSDLNPANGSYPFQALHQRAHGGIDVKVTSFTLAKYMSMLAASGPTWDQCPPFQWSKSPFHSMLHMGQPDLWMFSPIRVPWD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-BACE1 Antibody-PE (8D358)
TMAY-00206P-01 25 Tests

Anti-BACE1 Antibody-PE (8D358)

Sign In for Pricing
View Details
Anti-BACE1 Antibody-PE (8D358)
TMAY-00206P-02 100 Tests

Anti-BACE1 Antibody-PE (8D358)

Sign In for Pricing
View Details
C10orf96 Rabbit Polyclonal Antibody (Biotin)
orb2104339 100 µL

C10orf96 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Human phospholipase CZ1 (PLCZ1) ELISA Kit
YP-W17629-01 48 Tests

Human phospholipase CZ1 (PLCZ1) ELISA Kit

Sign In for Pricing
View Details
Human phospholipase CZ1 (PLCZ1) ELISA Kit
YP-W17629-02 96 Tests

Human phospholipase CZ1 (PLCZ1) ELISA Kit

Sign In for Pricing
View Details
TNFRSF11B Antibody, HRP conjugated
CSB-PA08229B0Rb-01 50 µg

TNFRSF11B Antibody, HRP conjugated

Sign In for Pricing
View Details